PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g078770.1
Common NameMTR_2g078770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 172aa    MW: 19628.9 Da    PI: 8.4159
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g078770.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.95.2e-4257133177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cqve+C adl+  k+yhrrhkvCevhska+vv+v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Medtr2g078770.1  57 ICQVESCGADLTFSKRYHRRHKVCEVHSKASVVVVAGMRQRFCQQCSRFHELAEFDESKRSCRRRLARHNERRRKST 133
                      5**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.9E-3453119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.47955132IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3856135IPR004333Transcription factor, SBP-box
PfamPF031104.0E-3258131IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEGKQTSVEK VWKDIIFEEI EVEEEEEGGV EDDEKKKGVC VSGRKEPSRG GRFSSPICQV  60
ESCGADLTFS KRYHRRHKVC EVHSKASVVV VAGMRQRFCQ QCSRFHELAE FDESKRSCRR  120
RLARHNERRR KSTAGTCTEG SSTGQKNNDG DWRQIHMNIT SSSGHDFLNF R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-34571311084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013464662.11e-123squamosa promoter-binding-like protein
SwissprotQ387418e-40SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A072VA581e-123A0A072VA58_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA13G35000.12e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-30squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]